Home > 3ds Max > 3ds Max 2013 Error Retrieving Configuration File

3ds Max 2013 Error Retrieving Configuration File

You can though install it from a created network deployment Admin image of 3ds Max Design 2009: \\server\share\AdminImage\support\backburner\ When installed, copy the Backburner folders and files from the C:\Program Files (x86)\Autodesk\ folder to Administrative permissions are recommended. Any one out there have any suggestions or solutions?ThanksElizabeth Reply 0 Kudos elizabethb Explorer 7 Posts

Post 2 of 9 Share Report Re: Error retrieving configuration files with max 2013 this can default by accident as well.-do you have fumefx? http://postmapper.com/3ds-max/3ds-max-error-retrieving-configuration-file.html

Compatibility: Windows 7, 8, Vista, XP Download Size: 6MB Requirements: 300 MHz Processor, 256 MB Ram, 22 MB HDD Limitations: This download is a free evaluation version. The gray icon means that the server is currently not available to render a job. Haha.Didn't have to close and restart Max either. Trackback this post | Subscribe to the comments via RSS Feed Search for: Recent Posts Managing a customized Style Library in InfraWorks How to use WMS in InfraWorks How to create

I think a lot of them were fixes for Max 2011 and below, so maybe that's why they did not work on mine. It should look like this: PlugPath=C:/Program Files/Autodesk/Backburner/ PROBLEM: The manager and server windows display strange, garbled text: Your error message includes @#$$#@. Are you sure you want to proceed?","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"/t5/forums/forumtopicpage.lineardisplay.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/area-b200/thread-id/80866&ticket=IngInUfnv5Cn_-1","ajaxErrorEventName":"LITHIUM:ajaxError","token":""}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ;(function($){ var skinAtdsA360 = "true" ; $(window).load(function(){ $(".autodesk-form-forummessage-author").each(function(index) { var role_icon_width = $(this).find(".lia-user-rank-icon-left").css("width"); var role_icon_rmargin = $(this).find(".lia-user-rank-icon-left").css("margin-right"); var You can learn more about log files in “Configuring Backburner Log Files” in the Autodesk Backburner User Guide at www.autodesk.com/backburner-documentation.

Tags: 3ds Max Design 2010, Backburner. New Post Related Content Search the Autodesk Knowledge Network for more content. This is usually caused by attempting to render large files over the network. Verify the bitmaps still reside in the shared directory.

Then use the Targa files as either an animated background in an empty 3ds Max scene, or as an image input event in Video Post and render the sequence out to This state can occur for several reasons, including: The server has not been correctly started. (See “Setting Up Backburner Server” in the Autodesk Backburner Installation Guide at www.autodesk.com/backburner-documentation.) The server has This is strange, because the installation forces the Backburner folder to the C:\Program Files (86)\Autodesk\Backburner\ folder. https://forums.autodesk.com/t5/forums/forumtopicprintpage/board-id/area-b200/message-id/107055/print-single-message/true/page/1 Register; Forgot Password; Login.

is there a way to manually fix this. Problem: When installing 3ds Max Design 2010/2011 on a Windows x64 platform and configurating the associated Backburner Server as a service for rendering in a render farm purpose, this render node This code is used by the vendor to identify the error caused. basic features: (repairs system freezing and rebooting issues , start-up customization , browser helper object management , program removal management , live updates , windows structure repair.) Recommended Solution Links: (1)

Click here follow the steps to fix Max Error Retrieving Configuration File and related errors. this page Open the created ‘Admin image' ini file in the AdminImage folder of the 2010 deployment and find the following text part: [Backburner] Now open the created ‘Admin image' ini file in the I may need to clarify a few things. First, Backburner Manager, Server, and Monitor are all communicating with one another.

angelsaiw360thoughts.blogspot.com/2016/09/infraw… 1weekago RT @infraworks360: A live animation in a live model - what could be cooler? this contact form I have just forwarded this onto a friend who had been conducting a little homework on this. All rights reserved "); }); // TOGGLE FUNCTION FOR THE MAIN FLYOUT MENU $(document).ready(function(){ $(".user_for_popup").click( function () { $(this).addClass('.user_for_popup_active'); } ); var MainContentHeight = $(".lia-quilt-column-main-content").height(); $(".lia-quilt-column-side-content").css( "min-height" , (MainContentHeight + About us Careers Contact us Investor relations Trust center Newsroom Privacy/Cookies (Updated) | Legal Notices & Trademarks | Report Noncompliance | Site map | © 2016 Autodesk Inc.

However, when I submit a MR job I get several errors (repeteatedly) on all 3 server nodes. The yellow icon means that the server is busy rendering another job. Enter RegEdit and click OK Browse to HKEY_LOCAL_MACHINE SOFTWARE Autodesk Backburner 2012 Check the CfgPath entry. have a peek here Visit the Forum FOLLOW AUTODESK Facebook Twitter YouTube LinkedIn All social media PRODUCTS 3D CAD software Construction software Drafting software Painting software Student downloads Design engineering Civil engineering PLM Character animation

Note: This article was updated on 2016-09-23 and previously published under WIKI_Q210794 Contents 1.What is Max Error Retrieving Configuration File error? 2.What causes Max Error Retrieving Configuration File error? 3.How to You could also do the following: If installed, use the Backburner version (2008.1.0) which comes with 3ds Max Design 2009. Autodesk Community > AREA > 3ds Max > Forum > Error retrieving configuration files with max 2013 using back burner Autodesk Media and Entertainment: 3ds Max: 3ds Max / 3ds Max

I miss Discreet, does any one out there remember when you could actually call and get help with 3ds Max issues?

Please see the Autodesk Creative Commons FAQ for more information. All errors are recorded in the appropriate log file. After you've setup the Backburner server, this version will place the Backburner.xml file in the C:\Program Files (x86)\Autodesk\Backburner\Network\ folder. Go to the AdminImage folder of the 2010 deployment and go to the sub folder ..\x86(/x64)\Support\ Replace the 2010 Backburner folder with the one from the 2009 deployment. For back up reasons I've

The path to 3ds Max is not set in the PlugPath section of the \Backburner\Network\nrapi.conf file. read 5229 times6/10/2013 5:56:48 AM (last edit: 6/10/2013 5:56:48 AM) msimecek You also might reconsider Re-installing Max or just backburner on one of your render machines. If the server should not be busy, verify that the queue is clear of jobs by opening the Queue Monitor and connecting to the Manager. Check This Out i've found their afterflics app messes up the network read 5258 times6/8/2013 5:57:06 AM (last edit: 6/8/2013 5:57:06 AM) 61mwhite Hi msimecek,Thank You for the response.

i think i've had the same problem before.you say you have 3 render nodes, can you also render on your Host Machine? Fill in your details below or click an icon to log in: Email (required) (Address never made public) Name (required) Website You are commenting using your WordPress.com account. (LogOut/Change) You are If you wish to continue the discussion, please create a new thread in the appropriate forum. SUGGESTION The Server has exceeded either the Wait For 3ds Max To Load or Wait For 3ds Max To Render value.

I have far better luck contacting my phone company with a billing problem and that is really saying something. Some of us are having no issues sending renderings to the render farm using back burner, others are getting error messages. "error retrieving configuration file" when they try to batch render. Site Version: 2.12.1 Autodesk Community > AREA > 3ds Max > Forum > Re: Error retrieving configuration files with max 2013 using back burner michaelwbell Contributor 20 Posts 4 Kudos 2 Or it could be that there is a total other way how to setup a render farm with Backburner which I've overlooked.

I would love to contact someone from Autodesk, but can not seems to find any way to contact them at all for help... It appears that the Backburner server (serversvc.exe) expects the configuration (backburner.xml) file to be in the C:\Program Files\Autodesk\Backburner\Network\ folder! On a brighter note we did find a fix. Illustrator Inventor Maya Revit Para Cloud Project Vasari RhinoRhinoscript SketchUp Technology Events Projects Search A digital design publication created & maintained by case Learning3ds MaxAutodeskBackburnerRendering 3ds Max - Rendering with Backburner

Make sure the value is set to c:\Program Files\Autodesk\Backburner\Network\nrapi.conf. Set the tab to "Never Notify" and hit ok. Showing results for  Search instead for  Do you mean  Search 3ds Max / 3ds Max Design Forum Post to the Community Have questions about Autodesk products? i can't recall which setting is correct for max 2014 but if you find it try toggling it.-when you submit a job are you sending it to the correct address in

© Copyright 2017 postmapper.com. All rights reserved.